PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00114.1.g00220.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 168aa    MW: 17895.8 Da    PI: 9.0037
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00114.1.g00220.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF611.4e-19955147
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                                  krien++  qv+f kR  g++KKA EL +LCda+v vi++ss  +ly
  Zpz_sc00114.1.g00220.1.am.mk  9 KRIENETSLQVSFNKRSRGLFKKARELGILCDAQVGVIVVSSISQLY 55
                                  79****************************************99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554553.79E-20171IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-23160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.399161IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-18323IPR002100Transcription factor, MADS-box
PfamPF003197.3E-191055IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MVRGKTVLKR IENETSLQVS FNKRSRGLFK KARELGILCD AQVGVIVVSS ISQLYCESSN  60
YRMEPLADIR EASRRKPTSH VVLNGPIDTS EATELPGHLR PSPAAALALR TGEPAAALAL  120
RVVEPAAALT LLIVCAACLD PPAAASIVPQ RAARLEEPSL GAAWPLGH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9SI381e-20ANR1_ARATH; MADS-box transcription factor ANR1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.16e-18AGAMOUS-like 44